OBP2B (NM_014581) Human Mass Spec Standard

CAT#: PH318732

OBP2B MS Standard C13 and N15-labeled recombinant protein (NP_055396)

Product Images

Coomassie blue staining of purified OBP2B protein (Cat# TP318732). The protein was produced from HEK293T cells transfected with OBP2B cDNA clone (Cat# RC218732) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218732
• Predicted MW: 19.5 kDa
• Protein Sequence:
  Sequence Link

  >RC218732 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGKLEATFTFMR
  EDRCIQKKILMRKTEEPGKYSAYGGRKLMYLQELPRRDHYIFYCKDQHHGGLLHMGKLVGRNSDTNREAL
  EEFKKLVQRKGLSEEDIFTPLQTGSCVPEH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055396
• RefSeq Size: 708
• RefSeq ORF: 510
• Synonyms: LCN14; OBPIIb
• Locus ID: 29989
• UniProt ID: Q9NPH6
• Cytogenetics: 9q34.2
• Summary: Probably binds and transports small hydrophobic volatile molecules.[UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein