OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OBP2B (NM_014581) Human Mass Spec Standard

Be the first to review this product
SKU
PH318732
OBP2B MS Standard C13 and N15-labeled recombinant protein (NP_055396)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA359094 OBP2B Antibody - C-terminal region
100 ul
$585.00
LY415181 Transient overexpression lysate of odorant binding protein 2B (OBP2B) (as WB positive control) 100 ug
$436.00

Other products for "OBP2B or NM_014581"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218732
Predicted MW 19.5 kDa
Protein Sequence
Protein Sequence
>RC218732 protein sequence
Red=Cloning site Green=Tags(s)

MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGKLEATFTFMR
EDRCIQKKILMRKTEEPGKYSAYGGRKLMYLQELPRRDHYIFYCKDQHHGGLLHMGKLVGRNSDTNREAL
EEFKKLVQRKGLSEEDIFTPLQTGSCVPEH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055396
RefSeq Size 708
RefSeq ORF 510
Synonyms LCN14; OBPIIb
Locus ID 29989
UniProt ID Q9NPH6
Cytogenetics 9q34.2
Summary Probably binds and transports small hydrophobic volatile molecules.UniProtKB/Swiss-Prot Function
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OBP2B" proteins (3)
SKU Description Size Price
LC415181 Lyophilized OBP2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415181 Transient overexpression lysate of odorant binding protein 2B (OBP2B) (as WB positive control) 100 ug
$436.00
TP318732 Recombinant protein of human odorant binding protein 2B (OBP2B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products