OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BSPRY (NM_017688) Human Mass Spec Standard

Be the first to review this product
SKU
PH318642
BSPRY MS Standard C13 and N15-labeled recombinant protein (NP_060158)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA372115 BSPRY rabbit polyclonal antibody
100 ul
$310.00
LY413602 Transient overexpression lysate of B-box and SPRY domain containing (BSPRY) (as WB positive control) 100 ug
$436.00

Other products for "BSPRY or NM_017688"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218642
Predicted MW 44.2 kDa
Protein Sequence
Protein Sequence
>RC218642 representing NM_017688
Red=Cloning site Green=Tags(s)

MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAEERAEELRNKI
VDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAH
QSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEIFERTEEAEGILDPQESEMLNFNEKCTR
SPLLTQLWATAVLGSLSGTEDIRIDERTVSPFLQLSDDRKTLTFSTKKSKACADGPERFDHWPNALAATS
FQNGLHAWMVNVQNSCAYKVGVASGHLPRKGSGSDCRLGHNAFSWVFSRYDQEFRFSHNGQHEPLGLLRG
PAQLGVVLDLQVQELLFYEPASGTVLCAHHVSFPGPLFPVFAVADQTISIVR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060158
RefSeq Size 2354
RefSeq ORF 1206
Locus ID 54836
UniProt ID Q5W0U4
Cytogenetics 9q32
Summary May regulate epithelial calcium transport by inhibiting TRPV5 activity.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BSPRY" proteins (3)
SKU Description Size Price
LC413602 Lyophilized BSPRY HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413602 Transient overexpression lysate of B-box and SPRY domain containing (BSPRY) (as WB positive control) 100 ug
$436.00
TP318642 Recombinant protein of human B-box and SPRY domain containing (BSPRY), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products