OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MARCHF2 (NM_001005415) Human Mass Spec Standard

Be the first to review this product
SKU
PH318593
MARCH2 MS Standard C13 and N15-labeled recombinant protein (NP_001005415)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA315456 Rabbit polyclonal anti-MARCH2 antibody
100 ul
$380.00
LY413937 Transient overexpression lysate of membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "MARCHF2 or NM_001005415"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218593
Predicted MW 26.8 kDa
Protein Sequence
Protein Sequence
>RC218593 representing NM_001005415
Red=Cloning site Green=Tags(s)

MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRTLDTPSDGPFCRICHEG
ANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCC
DMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKT
NQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001005415
RefSeq Size 1434
RefSeq ORF 738
Synonyms HSPC240; MARCH-II; MARCH2; RNF172
Locus ID 51257
UniProt ID Q9P0N8
Cytogenetics 19p13.2
Summary MARCH2 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH2 reduces surface accumulation of several glycoproteins and appears to regulate early endosome-to-trans-Golgi network (TGN) trafficking (Bartee et al., 2004 PubMed 14722266; Nakamura et al., 2005 PubMed 15689499).supplied by OMIM, Mar 2010
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MARCHF2" proteins (9)
SKU Description Size Price
PH307517 MARCH2 MS Standard C13 and N15-labeled recombinant protein (NP_057580) 10 ug
$3,360.00
LC413937 Lyophilized 42065 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423720 Lyophilized 42065 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423721 Lyophilized 42065 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413937 Transient overexpression lysate of membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423720 Transient overexpression lysate of membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY423721 Transient overexpression lysate of membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP307517 Recombinant protein of human membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 1, 20 µg 20 ug
$737.00
TP318593 Recombinant protein of human membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products