MARCHF2 (NM_001005415) Human Recombinant Protein

SKU
TP318593
Recombinant protein of human membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218593 representing NM_001005415
Red=Cloning site Green=Tags(s)

MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRTLDTPSDGPFCRICHEG
ANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCC
DMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKT
NQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001005415
Locus ID 51257
UniProt ID Q9P0N8
Cytogenetics 19p13.2
RefSeq Size 1434
RefSeq ORF 738
Synonyms HSPC240; MARCH-II; MARCH2; RNF172
Summary MARCH2 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH2 reduces surface accumulation of several glycoproteins and appears to regulate early endosome-to-trans-Golgi network (TGN) trafficking (Bartee et al., 2004 [PubMed 14722266]; Nakamura et al., 2005 [PubMed 15689499]).[supplied by OMIM, Mar 2010]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:MARCHF2 (NM_001005415) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH307517 MARCH2 MS Standard C13 and N15-labeled recombinant protein (NP_057580) 10 ug
$3,255.00
PH318593 MARCH2 MS Standard C13 and N15-labeled recombinant protein (NP_001005415) 10 ug
$3,255.00
LC413937 42065 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423720 42065 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423721 42065 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413937 Transient overexpression lysate of membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 1 100 ug
$436.00
LY423720 Transient overexpression lysate of membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 2 100 ug
$436.00
LY423721 Transient overexpression lysate of membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 3 100 ug
$436.00
TP307517 Recombinant protein of human membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.