OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OSGIN1 (NM_013370) Human Mass Spec Standard

Be the first to review this product
SKU
PH318475
OSGIN1 MS Standard C13 and N15-labeled recombinant protein (NP_037502)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA342142 Rabbit polyclonal Anti-OSGIN1 Antibody
100 ul
$585.00
LY405295 Transient overexpression lysate of oxidative stress induced growth inhibitor 1 (OSGIN1), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "OSGIN1 or NM_013370"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218475
Predicted MW 60.7 kDa
Protein Sequence
Protein Sequence
>RC218475 representing NM_013370
Red=Cloning site Green=Tags(s)

MGKWRPRGCCRGNMQCRQEVPATLTSSELFSTRNQPQPQPQPLLADAPVPWAVASRMCLTPGQGCGHQGQ
DEGPLPAPSPPPAMSSSRKDHLGASSSEPLPVIIVGNGPSGICLSYLLSGYTPYTKPDAIHPHPLLQRKL
TEAPGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTWKHRKEHAIPHVVLGRNLP
GGAWHSIEGSMVILSQGQWMGLPDLEVKDWMQKKRRGLRNSRATAGDIAHYYRDYVVKKGLGHNFVSGAV
VTAVEWGTPDPSSCGAQDSSPLFQVSGFLTRNQAQQPFSLWARNVVLATGTFDSPARLGIPGEALPFIHH
ELSALEAATRVGAVTPASDPVLIIGAGLSAADAVLYARHYNIPVIHAFRRAVDDPGLVFNQLPKMLYPEY
HKVHQMMREQSILSPSPYEGYRSLPRHQLLCFKEDCQAVFQDLEGVEKVFGVSLVLVLIGSHPDLSFLPG
AGADFAVDPDQPLSAKRNPIDVDPFTYQSTRQEGLYAMGPLAGDNFVRFVQGGALAVASSLLRKETRKPP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037502
RefSeq Size 2400
RefSeq ORF 1680
Synonyms BDGI; OKL38
Locus ID 29948
UniProt ID Q9UJX0
Cytogenetics 16q23.3
Summary This gene encodes an oxidative stress response protein that regulates cell death. Expression of the gene is regulated by p53 and is induced by DNA damage. The protein regulates apoptosis by inducing cytochrome c release from mitochondria. It also appears to be a key regulator of both inflammatory and anti-inflammatory molecules. The loss of this protein correlates with uncontrolled cell growth and tumor formation. Naturally occurring read-through transcription exists between this gene and the neighboring upstream malonyl-CoA decarboxylase (MLYCD) gene, but the read-through transcripts are unlikely to produce a protein product. provided by RefSeq, Aug 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OSGIN1" proteins (5)
SKU Description Size Price
LC405295 Lyophilized OSGIN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415630 Lyophilized OSGIN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405295 Transient overexpression lysate of oxidative stress induced growth inhibitor 1 (OSGIN1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY415630 Transient overexpression lysate of oxidative stress induced growth inhibitor 1 (OSGIN1), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP318475 Recombinant protein of human oxidative stress induced growth inhibitor 1 (OSGIN1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products