SNRPC (NM_003093) Human Mass Spec Standard
CAT#: PH318418
SNRPC MS Standard C13 and N15-labeled recombinant protein (NP_003084)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218418 |
Predicted MW | 17.2 kDa |
Protein Sequence |
>RC218418 representing NM_003093
Red=Cloning site Green=Tags(s) MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAP PPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMR PPARPMMVPTRPGMTRPDR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003084 |
RefSeq Size | 733 |
RefSeq ORF | 477 |
Synonyms | U1C; Yhc1 |
Locus ID | 6631 |
UniProt ID | P09234, Q5TAL4 |
Cytogenetics | 6p21.31 |
Summary | This gene encodes one of the specific protein components of the U1 small nuclear ribonucleoprotein (snRNP) particle required for the formation of the spliceosome. The encoded protein participates in the processing of nuclear precursor messenger RNA splicing. snRNP particles are attacked by autoantibodies frequently produced by patients with connective tissue diseases. The genome contains several pseudogenes of this functional gene. Alternative splicing results in a non-coding transcript variant.[provided by RefSeq, Oct 2009] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418904 | SNRPC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY418904 | Transient overexpression lysate of small nuclear ribonucleoprotein polypeptide C (SNRPC), transcript variant 1 |
USD 436.00 |
|
TP318418 | Recombinant protein of human small nuclear ribonucleoprotein polypeptide C (SNRPC), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review