OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB3IP (NM_022456) Human Mass Spec Standard

Be the first to review this product
SKU
PH318153
RAB3IP MS Standard C13 and N15-labeled recombinant protein (NP_071901)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA808960 RAB3IP mouse monoclonal antibody,clone OTI5F2 100 ul
$447.00
LY406273 Transient overexpression lysate of RAB3A interacting protein (rabin3) (RAB3IP), transcript variant beta 1 (as WB positive control) 100 ug
$436.00

Other products for "RAB3IP or NM_022456"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218153
Predicted MW 51.1 kDa
Protein Sequence
Protein Sequence
>RC218153 representing NM_022456
Red=Cloning site Green=Tags(s)

MANDPLEGFHEVNLASPTSPDLLGVYESGTQEQTTSPSVIYRPHPSALSSVPIQANALDVSELPTQPVYS
SPRRLNCAEISSISFHVTDPAPCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTD
SLSRLRSPSVLEVREKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVRE
ANIKQATAEKQLKEAQGKIDVLQAEVAALKTLVLSSSPTSPTQEPLPGGKTPFKKGHTRNKSTSSAMSGS
HQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLTFSKSELASAVLEAVEN
NTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGDSSNYYYISPFCRYRITSVCNFFTY
IRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071901
RefSeq Size 1855
RefSeq ORF 1380
Synonyms RABIN3; RABIN8
Locus ID 117177
UniProt ID Q96QF0
Cytogenetics 12q15
Summary Guanine nucleotide exchange factor (GEF) which may activate RAB8A and RAB8B. Promotes the exchange of GDP to GTP, converting inactive GDP-bound Rab proteins into their active GTP-bound form. Mediates the release of GDP from RAB8A and RAB8B but not from RAB3A or RAB5. Modulates actin organization and promotes polarized transport of RAB8A-specific vesicles to the cell surface. Together with RAB11A, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAB3IP" proteins (8)
SKU Description Size Price
LC406273 Lyophilized RAB3IP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC411671 Lyophilized RAB3IP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422524 Lyophilized RAB3IP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406273 Transient overexpression lysate of RAB3A interacting protein (rabin3) (RAB3IP), transcript variant beta 1 (as WB positive control) 100 ug
$436.00
LY411671 Transient overexpression lysate of RAB3A interacting protein (rabin3) (RAB3IP), transcript variant alpha 1 (as WB positive control) 100 ug
$665.00
LY422524 Transient overexpression lysate of RAB3A interacting protein (rabin3) (RAB3IP), transcript variant A (as WB positive control) 100 ug
$436.00
TP318153 Recombinant protein of human RAB3A interacting protein (rabin3) (RAB3IP), transcript variant alpha 1, 20 µg 20 ug
$867.00
TP760069 Recombinant protein of human RAB3A interacting protein (rabin3) (RAB3IP), transcript variant A, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products