RAB3IP (NM_022456) Human Recombinant Protein
SKU
TP318153
Recombinant protein of human RAB3A interacting protein (rabin3) (RAB3IP), transcript variant alpha 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC218153 representing NM_022456
Red=Cloning site Green=Tags(s) MANDPLEGFHEVNLASPTSPDLLGVYESGTQEQTTSPSVIYRPHPSALSSVPIQANALDVSELPTQPVYS SPRRLNCAEISSISFHVTDPAPCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTD SLSRLRSPSVLEVREKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVRE ANIKQATAEKQLKEAQGKIDVLQAEVAALKTLVLSSSPTSPTQEPLPGGKTPFKKGHTRNKSTSSAMSGS HQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLTFSKSELASAVLEAVEN NTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGDSSNYYYISPFCRYRITSVCNFFTY IRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_071901 |
Locus ID | 117177 |
UniProt ID | Q96QF0 |
Cytogenetics | 12q15 |
RefSeq Size | 1855 |
RefSeq ORF | 1380 |
Synonyms | RABIN3; RABIN8 |
Summary | Guanine nucleotide exchange factor (GEF) which may activate RAB8A and RAB8B. Promotes the exchange of GDP to GTP, converting inactive GDP-bound Rab proteins into their active GTP-bound form. Mediates the release of GDP from RAB8A and RAB8B but not from RAB3A or RAB5. Modulates actin organization and promotes polarized transport of RAB8A-specific vesicles to the cell surface. Together with RAB11A, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH318153 | RAB3IP MS Standard C13 and N15-labeled recombinant protein (NP_071901) | 10 ug |
$3,255.00
|
|
LC406273 | RAB3IP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC411671 | RAB3IP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC422524 | RAB3IP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY406273 | Transient overexpression lysate of RAB3A interacting protein (rabin3) (RAB3IP), transcript variant beta 1 | 100 ug |
$436.00
|
|
LY411671 | Transient overexpression lysate of RAB3A interacting protein (rabin3) (RAB3IP), transcript variant alpha 1 | 100 ug |
$665.00
|
|
LY422524 | Transient overexpression lysate of RAB3A interacting protein (rabin3) (RAB3IP), transcript variant A | 100 ug |
$436.00
|
|
TP760069 | Recombinant protein of human RAB3A interacting protein (rabin3) (RAB3IP), transcript variant A, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.