LBX1 (NM_006562) Human Mass Spec Standard

CAT#: PH318048

LBX1 MS Standard C13 and N15-labeled recombinant protein (NP_006553)

Product Images

Coomassie blue staining of purified LBX1 protein (Cat# TP318048). The protein was produced from HEK293T cells transfected with LBX1 cDNA clone (Cat# RC218048) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218048
• Predicted MW: 30 kDa
• Protein Sequence:
  Sequence Link

  >RC218048 representing NM_006562
  Red=Cloning site Green=Tags(s)
  
  MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGG
  LPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYEL
  EKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAE
  LEQNSEATAGGGGGCGRAKSRPGSPVLPPGAPKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVD
  D
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006553
• RefSeq Size: 1287
• RefSeq ORF: 843
• Synonyms: homeobox; HPX-6; HPX6; LBX1H
• Locus ID: 10660
• UniProt ID: P52954
• Cytogenetics: 10q24.32
• Summary: This gene and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal identities of forelimb muscles. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors