OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C19orf2 (URI1) (NM_003796) Human Mass Spec Standard

Be the first to review this product
SKU
PH317842
C19orf2 MS Standard C13 and N15-labeled recombinant protein (NP_003787)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA339790 Rabbit Polyclonal Anti-URI1 Antibody
100 ul
$585.00
LY418431 Transient overexpression lysate of chromosome 19 open reading frame 2 (C19orf2), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "C19orf2 or NM_003796"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217842
Predicted MW 59.7 kDa
Protein Sequence
Protein Sequence
>RC217842 representing NM_003796
Red=Cloning site Green=Tags(s)

MEAPTVETPPDPSPPSAPAPALVPLRAPDVARLREEQEKVVTNCQERIQHWKKVDNDYNALRERLSTLPD
KLSYNIMVPFGPFAFMPGKLVHTNEVTVLLGDNWFAKCSAKQAVGLVEHRKEHVRKTIDDLKKVMKNFES
RVEFTEDLQKMSDAAGDIVDIREEIKCDFEFKAKHRIAHKPHSKPKTSDIFEADIANDVKSKDLLADKEL
WARLEELERQEELLGELDSKPDTVIANGEDTTSSEEEKEDRNTNVNAMHQVTDSHTPCHKDVASSEPFSG
QVNSQLNCSVNGSSSYHSDDDDDDDDDDDDDNIDDDDGDNDHEALGVGDNSIPTIYFSHTVEPKRVRINT
GKNTTLKFSEKKEEAKRKRKNSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVC
SDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPEAFSGTVIEKEFVSPS
LTPPPAIAHPALPTIPERKEVLLEASEETGKRVSKFKAARLQQKD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003787
RefSeq Size 2295
RefSeq ORF 1605
Synonyms C19orf2; NNX3; PPP1R19; RMP; URI
Locus ID 8725
UniProt ID O94763
Cytogenetics 19q12
Summary This gene encodes member of the prefoldin family of molecular chaperones. The encoded protein functions as a scaffolding protein and plays roles in ubiquitination and transcription, in part though interactions with the RNA polymerase II subunit RPB5. This gene may play a role in multiple malignancies including ovarian cancer and hepatocellular carcinoma. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 22. provided by RefSeq, Nov 2011
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C19orf2" proteins (3)
SKU Description Size Price
LC418431 Lyophilized URI1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418431 Transient overexpression lysate of chromosome 19 open reading frame 2 (C19orf2), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP317842 Purified recombinant protein of Homo sapiens chromosome 19 open reading frame 2 (C19orf2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products