OriGene Logo

C19orf2 (URI1) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339790
Rabbit Polyclonal Anti-URI1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY418431 Transient overexpression lysate of chromosome 19 open reading frame 2 (C19orf2), transcript variant 1 100 ug
$665.00
TP317842 Purified recombinant protein of Homo sapiens chromosome 19 open reading frame 2 (C19orf2), transcript variant 1, 20 µg
20 ug
$867.00

View other "C19orf2 or NM_134447" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C19orf2 antibody: synthetic peptide directed towards the middle region of human C19orf2. Synthetic peptide located within the following region: NGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 55 kDa
Gene Name URI1 prefoldin-like chaperone
Database Link
Background The function of the C19orf2 protein remains unknown.The protein encoded by this gene binds to RNA polymerase II subunit 5 (RPB5) and negatively modulates transcription through its binding to RPB5. The encoded protein seems to have inhibitory effects on various types of activated transcription, but it requires the RPB5-binding region. This protein acts as a corepressor. It is suggested that it may require signaling processes for its function or that it negatively modulates genes in the chromatin structure. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Synonyms FLJ10575; NNX3; RMP; URI
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Rat: 80%; Mouse: 79%
Reference Data
Protein Categories Growth Factors, Intracellular Proteins
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.