OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PTBP1 (NM_031990) Human Mass Spec Standard

Be the first to review this product
SKU
PH317785
PTBP1 MS Standard C13 and N15-labeled recombinant protein (NP_114367)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY410401 Transient overexpression lysate of polypyrimidine tract binding protein 1 (PTBP1), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "PTBP1 or NM_031990"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217785
Predicted MW 58.9 kDa
Protein Sequence
Protein Sequence
>RC217785 representing NM_031990
Red=Cloning site Green=Tags(s)

MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHIRKLPIDV
TEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDS
SPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLHQIFSKFGTV
LKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDL
PSGDSQPSLDQTMAAAFASPYAGAGFPPTFAIPQAAGLSVPNVHGALAPLAIPSAAAAAAAAGRIAIPGL
AGAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHG
KPIRITLSKHQNVQLPREGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLK
VLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_114367
RefSeq Size 3300
RefSeq ORF 1650
Synonyms HNRNP-I; HNRNPI; HNRPI; pPTB; PTB; PTB-1; PTB-T; PTB2; PTB3; PTB4
Locus ID 5725
UniProt ID P26599
Cytogenetics 19p13.3
Summary This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has four repeats of quasi-RNA recognition motif (RRM) domains that bind RNAs. This protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs. This protein is localized in the nucleoplasm and it is also detected in the perinucleolar structure. Alternatively spliced transcript variants encoding different isoforms have been described. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PTBP1" proteins (9)
SKU Description Size Price
PH301779 PTBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002810) 10 ug
$3,360.00
LC410400 Lyophilized PTBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC410401 Lyophilized PTBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419090 Lyophilized PTBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410400 Transient overexpression lysate of polypyrimidine tract binding protein 1 (PTBP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY410401 Transient overexpression lysate of polypyrimidine tract binding protein 1 (PTBP1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY419090 Transient overexpression lysate of polypyrimidine tract binding protein 1 (PTBP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301779 Recombinant protein of human polypyrimidine tract binding protein 1 (PTBP1), transcript variant 1, 20 µg 20 ug
$737.00
TP317785 Recombinant protein of human polypyrimidine tract binding protein 1 (PTBP1), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products