PTBP1 (NM_002819) Human Mass Spec Standard

SKU
PH301779
PTBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002810)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201779]
Predicted MW 59.6 kDa
Protein Sequence
Protein Sequence
>RC201779 protein sequence
Red=Cloning site Green=Tags(s)

MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHIRKLPIDV
TEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDS
SPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLHQIFSKFGTV
LKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDL
PSGDSQPSLDQTMAAAFGAPGIISASPYAGAGFPPTFAIPQAAGLSVPNVHGALAPLAIPSAAAAAAAAG
RIAIPGLAGAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHL
NGHKLHGKPIRITLSKHQNVQLPREGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPS
VSEEDLKVLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002810
RefSeq Size 3340
RefSeq ORF 1671
Synonyms HNRNP-I; HNRNPI; HNRPI; pPTB; PTB; PTB-1; PTB-T; PTB2; PTB3; PTB4
Locus ID 5725
UniProt ID P26599
Cytogenetics 19p13.3
Summary This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has four repeats of quasi-RNA recognition motif (RRM) domains that bind RNAs. This protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs. This protein is localized in the nucleoplasm and it is also detected in the perinucleolar structure. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:PTBP1 (NM_002819) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH317785 PTBP1 MS Standard C13 and N15-labeled recombinant protein (NP_114367) 10 ug
$3,255.00
LC410400 PTBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC410401 PTBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419090 PTBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410400 Transient overexpression lysate of polypyrimidine tract binding protein 1 (PTBP1), transcript variant 2 100 ug
$436.00
LY410401 Transient overexpression lysate of polypyrimidine tract binding protein 1 (PTBP1), transcript variant 3 100 ug
$436.00
LY419090 Transient overexpression lysate of polypyrimidine tract binding protein 1 (PTBP1), transcript variant 1 100 ug
$436.00
TP301779 Recombinant protein of human polypyrimidine tract binding protein 1 (PTBP1), transcript variant 1, 20 µg 20 ug
$737.00
TP317785 Recombinant protein of human polypyrimidine tract binding protein 1 (PTBP1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.