GLIPR2 (NM_022343) Human Mass Spec Standard

CAT#: PH317501

GLIPR2 MS Standard C13 and N15-labeled recombinant protein (NP_071738)

Product Images

Coomassie blue staining of purified GLIPR2 protein (Cat# TP317501). The protein was produced from HEK293T cells transfected with GLIPR2 cDNA clone (Cat# RC217501) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217501
• Predicted MW: 17 kDa
• Protein Sequence:
  Sequence Link

  >RC217501 representing NM_022343
  Red=Cloning site Green=Tags(s)
  
  MGKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWA
  SYDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVV
  NEGFFEENVLPPKK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071738
• RefSeq Size: 1900
• RefSeq ORF: 462
• Synonyms: C9orf19; GAPR-1; GAPR1
• Locus ID: 152007
• UniProt ID: Q9H4G4
• Cytogenetics: 9p13.3