OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SAMD7 (NM_182610) Human Mass Spec Standard

Be the first to review this product
SKU
PH317500
SAMD7 MS Standard C13 and N15-labeled recombinant protein (NP_872416)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350388 Rabbit Polyclonal Anti-SAMD7 rabbit polyclonal antibody
100 ul
$205.00
LY405456 Transient overexpression lysate of sterile alpha motif domain containing 7 (SAMD7) (as WB positive control) 100 ug
$665.00

Other products for "SAMD7 or NM_182610"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217500
Predicted MW 48.9 kDa
Protein Sequence
Protein Sequence
>RC217500 representing NM_182610
Red=Cloning site Green=Tags(s)

MAVNPLLTPTGQQTIPLIPSPFGPPTVDRDVLPSTVAPTDPRQFCVPSQFGSSVLPNTNMANVLSSRIYP
GWGILPPESIKAVARRNEMIQRHHTARTEMEMYAIYQQRRMEKINPKGLAGLGIPFLYGSSVPAAPAAYH
GRSMLPAGDLHFHRSTLRNLQGNPMLAATAPHFEESWGQRCRRLRKNTGNQKALDSDAESSKSQAEEKIL
GQTHAVPYEEDHYAKDPDIEAPSNQKSSETNEKPTTALANTCGELEPTHRKPWGSHTTTLKAKAWDDGKE
EASEQIFATCDEKNGVCPPVPRPSLPGTHALVTIGGNLSLDEDIQKWTVDDVHSFIRSLPGCSDYAQVFK
DHAIDGETLPLLTEEHLRGTMGLKLGPALKIQSQVSQHVGSMFYKKTLSFPIRQAFDQPADTSPLLDPNS
WSDTMNIFCPQDTIIPKGIERGSMRN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_872416
RefSeq Size 2281
RefSeq ORF 1338
Locus ID 344658
UniProt ID Q7Z3H4
Cytogenetics 3q26.2
Summary Involved in the regulation of gene expression in the retina. It functions as a negative regulator of CRX-controlled genes.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SAMD7" proteins (3)
SKU Description Size Price
LC405456 Lyophilized SAMD7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405456 Transient overexpression lysate of sterile alpha motif domain containing 7 (SAMD7) (as WB positive control) 100 ug
$665.00
TP317500 Recombinant protein of human sterile alpha motif domain containing 7 (SAMD7), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products