SAMD7 (NM_182610) Human Recombinant Protein

SKU
TP317500
Recombinant protein of human sterile alpha motif domain containing 7 (SAMD7), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217500 representing NM_182610
Red=Cloning site Green=Tags(s)

MAVNPLLTPTGQQTIPLIPSPFGPPTVDRDVLPSTVAPTDPRQFCVPSQFGSSVLPNTNMANVLSSRIYP
GWGILPPESIKAVARRNEMIQRHHTARTEMEMYAIYQQRRMEKINPKGLAGLGIPFLYGSSVPAAPAAYH
GRSMLPAGDLHFHRSTLRNLQGNPMLAATAPHFEESWGQRCRRLRKNTGNQKALDSDAESSKSQAEEKIL
GQTHAVPYEEDHYAKDPDIEAPSNQKSSETNEKPTTALANTCGELEPTHRKPWGSHTTTLKAKAWDDGKE
EASEQIFATCDEKNGVCPPVPRPSLPGTHALVTIGGNLSLDEDIQKWTVDDVHSFIRSLPGCSDYAQVFK
DHAIDGETLPLLTEEHLRGTMGLKLGPALKIQSQVSQHVGSMFYKKTLSFPIRQAFDQPADTSPLLDPNS
WSDTMNIFCPQDTIIPKGIERGSMRN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 48.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_872416
Locus ID 344658
UniProt ID Q7Z3H4
Cytogenetics 3q26.2
RefSeq Size 2281
RefSeq ORF 1338
Summary Involved in the regulation of gene expression in the retina. It functions as a negative regulator of CRX-controlled genes.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SAMD7 (NM_182610) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH317500 SAMD7 MS Standard C13 and N15-labeled recombinant protein (NP_872416) 10 ug
$3,255.00
LC405456 SAMD7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405456 Transient overexpression lysate of sterile alpha motif domain containing 7 (SAMD7) 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.