OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CDADC1 (NM_030911) Human Mass Spec Standard

Be the first to review this product
SKU
PH317484
CDADC1 MS Standard C13 and N15-labeled recombinant protein (NP_112173)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA369932 CDADC1 rabbit polyclonal antibody
100 ul
$310.00
LY434270 Transient overexpression lysate of cytidine and dCMP deaminase domain containing 1 (CDADC1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "CDADC1 or NM_030911"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217484
Predicted MW 58.5 kDa
Protein Sequence
Protein Sequence
>RC217484 protein sequence
Red=Cloning site Green=Tags(s)

MKEAGQMQNLESARAGRSVSTQTGSMTGQIPRLSKVNLFTLLSLWMELFPAEAQRQKSQKNEEGKHGPLG
DNEERTRVSTDKRQVKRTGLVVVKNMKIVGLHCSSEDLHAGQIALIKHGSRLKNCDLYFSRKPCSACLKM
IVNAGVNRISYWPADPEISLLTEASSSEDAKLDAKAVERLKSNSRAHVCVLLQPLVCYMVQFVEETSYKC
DFIQKITKTLPDANTDFYYECKQERIKEYEMLFLVSNEEMHKQILMTIGLENLCENPYFSNLRQNMKDLI
LLLATVASSVPNFKHFGFYRSNPEQINEIHNQSLPQEIARHCMVQARLLAYRTEDHKTGVGAVIWAEGKS
RSCDGTGAMYFVGCGYNAFPVGSEYADFPHMDDKQKDREIRKFRYIIHAEQNALTFRCQEIKPEERSMIF
VTKCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMRFGELEGVSKFTWQLNPSGAYGLEQNEPERRE
NGVLRPVPQKEEQHQDKKLRLGIH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112173
RefSeq Size 3417
RefSeq ORF 1542
Synonyms bA103J18.1; NYD-SP15
Locus ID 81602
UniProt ID Q9BWV3
Cytogenetics 13q14.2
Summary May play an important role in testicular development and spermatogenesis.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CDADC1" proteins (5)
SKU Description Size Price
LC410668 Lyophilized CDADC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434270 Lyophilized CDADC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410668 Transient overexpression lysate of cytidine and dCMP deaminase domain containing 1 (CDADC1) (as WB positive control) 100 ug
$665.00
LY434270 Transient overexpression lysate of cytidine and dCMP deaminase domain containing 1 (CDADC1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP317484 Recombinant protein of human cytidine and dCMP deaminase domain containing 1 (CDADC1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products