CEACAM3 (NM_001815) Human Mass Spec Standard

CAT#: PH317469

CEACAM3 MS Standard C13 and N15-labeled recombinant protein (NP_001806)

Product Images

Coomassie blue staining of purified CEACAM3 protein (Cat# TP317469). The protein was produced from HEK293T cells transfected with CEACAM3 cDNA clone (Cat# RC217469) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217469
• Predicted MW: 27.1 kDa
• Protein Sequence:
  Sequence Link

  >RC217469 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKG
  ERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHV
  YQENAPGLPVGAVAGIVTGVLVGVALVAALVCFLLLAKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSM
  SPLSTAQAPLPNPRTAASIYEELLKHDTNIYCRMDHKAEVAS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001806
• RefSeq Size: 1163
• RefSeq ORF: 756
• Synonyms: CD66D; CEA; CGM1; W264; W282
• Locus ID: 1084
• UniProt ID: P40198
• Cytogenetics: 19q13.2
• Summary: This gene encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several bacterial species that is dependent on the small GTPase Rac. It is thought to serve an important role in controlling human-specific pathogens by the innate immune system. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2013]
• Protein Families: Transmembrane