OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CEACAM3 (NM_001815) Human Mass Spec Standard

Be the first to review this product
SKU
PH317469
CEACAM3 MS Standard C13 and N15-labeled recombinant protein (NP_001806)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350818 Rabbit Polyclonal Anti-CEACAM3 Antibody
100 ul
$205.00
LY419723 Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3) (as WB positive control) 100 ug
$436.00

Other products for "CEACAM3 or NM_001815"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217469
Predicted MW 27.1 kDa
Protein Sequence
Protein Sequence
>RC217469 protein sequence
Red=Cloning site Green=Tags(s)

MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKG
ERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHV
YQENAPGLPVGAVAGIVTGVLVGVALVAALVCFLLLAKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSM
SPLSTAQAPLPNPRTAASIYEELLKHDTNIYCRMDHKAEVAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001806
RefSeq Size 1163
RefSeq ORF 756
Synonyms CD66D; CEA; CGM1; W264; W282
Locus ID 1084
UniProt ID P40198
Cytogenetics 19q13.2
Summary This gene encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several bacterial species that is dependent on the small GTPase Rac. It is thought to serve an important role in controlling human-specific pathogens by the innate immune system. Alternatively spliced transcript variants have been described. provided by RefSeq, Mar 2013
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CEACAM3" proteins (4)
SKU Description Size Price
LC419723 Lyophilized CEACAM3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419723 Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3) (as WB positive control) 100 ug
$436.00
TP317469 Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3), 20 µg 20 ug
$737.00
TP720376 Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3) 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products