OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BARHL2 (NM_020063) Human Mass Spec Standard

Be the first to review this product
SKU
PH317326
BARHL2 MS Standard C13 and N15-labeled recombinant protein (NP_064447)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA329727 Rabbit Polyclonal Anti-BARHL2 Antibody
100 ul
$585.00
LY412652 Transient overexpression lysate of BarH-like homeobox 2 (BARHL2) (as WB positive control) 100 ug
$436.00

Other products for "BARHL2 or NM_020063"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217326
Predicted MW 42 kDa
Protein Sequence
Protein Sequence
>RC217326 protein sequence
Red=Cloning site Green=Tags(s)

MTMEGASGSSFGIDTILSSASSGSPGMMNGDFRPLGEARTADFRSQATPSPCSEIDTVGTAPSSPISVTM
EPPEPHLVADATQHHHHLHHSQQPPPPAAAPTQSLQPLPQQQQPLPPQQPPPPPPQQLGSAASAPRTSTS
SFLIKDILGDSKPLAACAPYSTSVSSPHHTPKQESNAVHESFRPKLEQEDSKTKLDKREDSQSDIKCHGT
KEEGDREITSSRESPPVRAKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWY
QNRRTKWKRQTAVGLELLAEAGNYSALQRMFPSPYFYHPSLLGSMDSTTAAAAAAAMYSSMYRTPPAPHP
QLQRPLVPRVLIHGLGPGGQPALNPLSSPIPGTPHPR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_064447
RefSeq Size 1496
RefSeq ORF 1161
Locus ID 343472
UniProt ID Q9NY43
Cytogenetics 1p22.2
Summary Potential regulator of neural basic helix-loop-helix genes.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BARHL2" proteins (3)
SKU Description Size Price
LC412652 Lyophilized BARHL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412652 Transient overexpression lysate of BarH-like homeobox 2 (BARHL2) (as WB positive control) 100 ug
$436.00
TP317326 Recombinant protein of human BarH-like homeobox 2 (BARHL2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products