BARHL2 Rabbit Polyclonal Antibody

SKU TA329727

Rabbit Polyclonal Anti-BARHL2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BARHL2 antibody: synthetic peptide directed towards the middle region of human BARHL2. Synthetic peptide located within the following region: SSPHHTPKQESNAVHESFRPKLEQEDSKTKLDKREDSQSDIKCHGTKEEG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: BarH like homeobox 2
• Database Link:
  NP_064447
  Q9NY43
• Background: BARHL2 and BARHL1 are two homeobox genes in mouse and human, which are highly related to the Bar Drosophila genes.
• Synonyms: BarH-like 2; BarH-like homeobox 2; OTTHUMP00000011704
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Bovine: 86%; Zebrafish: 77%

Reference Data