MAL (NM_022438) Human Mass Spec Standard

CAT#: PH317248

MAL MS Standard C13 and N15-labeled recombinant protein (NP_071883)

Product Images

Coomassie blue staining of purified MAL protein (Cat# TP317248). The protein was produced from HEK293T cells transfected with MAL cDNA clone (Cat# RC217248) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217248
• Predicted MW: 11.9 kDa
• Protein Sequence:
  Sequence Link

  >RC217248 representing NM_022438
  Red=Cloning site Green=Tags(s)
  
  MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLI
  ILYIIGAHGGETSWVTLVFSYIATLLYVVHAVFSLIRWKSS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071883
• RefSeq Size: 930
• RefSeq ORF: 333
• Synonyms: MVP17; VIP17
• Locus ID: 4118
• UniProt ID: P21145
• Cytogenetics: 2q11.1
• Summary: The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal transduction. In addition, this proteolipid is localized in compact myelin of cells in the nervous system and has been implicated in myelin biogenesis and/or function. The protein plays a role in the formation, stabilization and maintenance of glycosphingolipid-enriched membrane microdomains. Down-regulation of this gene has been associated with a variety of human epithelial malignancies. Alternative splicing produces four transcript variants which vary from each other by the presence or absence of alternatively spliced exons 2 and 3. [provided by RefSeq, May 2012]
• Protein Families: Transmembrane