OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GMEB1 (NM_006582) Human Mass Spec Standard

Be the first to review this product
SKU
PH317117
GMEB1 MS Standard C13 and N15-labeled recombinant protein (NP_006573)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA334739 Rabbit Polyclonal Anti-GMEB1 Antibody
100 ul
$585.00
LY411280 Transient overexpression lysate of glucocorticoid modulatory element binding protein 1 (GMEB1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "GMEB1 or NM_006582"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217117
Predicted MW 62.4 kDa
Protein Sequence
Protein Sequence
>RC217117 representing NM_006582
Red=Cloning site Green=Tags(s)

MANAEVSVPVGDVVVVPTEGNEGENPEDTKTQVILQLQPVQQGLFIDGHFYNRIYEAGSENNTAVVAVET
HTIHKIEEGIDTGTIEANEDMEIAYPITCGESKAILLWKKFVCPGINVKCVKFNDQLISPKHFVHLAGKS
TLKDWKRAIRLGGIMLRKMMDSGQIDFYQHDKVCSNTCRSTKFDLLISSARAPVPGQQTSVVQTPTSADG
SITQIAISEESMEEAGLEWNSALTAAVTMATEEGVKKDSEEISEDTLMFWKGIADVGLMEEVVCNIQKEI
EELLRGVQQRLIQAPFQVTDAAVLNNVAHTFGLMDTVKKVLDNRRNQVEQGEEQFLYTLTDLERQLEEQK
KQGQDHRLKSQTVQNVVLMPVSTPKPPKRPRLQRPASTTVLSPSPPVQQPQFTVISPITITPVGQSFSMG
NIPVATLSQGSSPVTVHTLPSGPQLFRYATVVSSAKSSSPDTVTIHPSSSLALLSSTAMQDGSTLGNMTT
MVSPVELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAVILETELRTEEKVVAEMEEHQ
HQVHNVEIVVLED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006573
RefSeq Size 1960
RefSeq ORF 1719
Synonyms P96PIF; PIF96
Locus ID 10691
UniProt ID Q9Y692
Cytogenetics 1p35.3
Summary This gene encodes a member of KDWK gene family which associates with GMEB2 protein. The GMEB1-GMEB2 complex is essential for parvovirus DNA replication. Studies in rat for a similar gene suggest that this gene's role is to modulate the transactivation of the glucocorticoid receptor when it is bound to glucocorticoid response elements. Three alternative spliced transcript variants encoding different isoforms exist. provided by RefSeq, Feb 2016
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GMEB1" proteins (6)
SKU Description Size Price
PH300152 GMEB1 MS Standard C13 and N15-labeled recombinant protein (NP_077808) 10 ug
$3,360.00
LC411280 Lyophilized GMEB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411280 Transient overexpression lysate of glucocorticoid modulatory element binding protein 1 (GMEB1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300152 Recombinant protein of human glucocorticoid modulatory element binding protein 1 (GMEB1), transcript variant 2, 20 µg 20 ug
$867.00
TP317117 Recombinant protein of human glucocorticoid modulatory element binding protein 1 (GMEB1), transcript variant 1, 20 µg 20 ug
$867.00
TP710006 Recombinant protein of human glucocorticoid modulatory element binding protein 1 (GMEB1), full length, with C-terminal polyhistidine tag,expressed in sf9 cells 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products