GMEB1 (NM_024482) Human Mass Spec Standard

SKU
PH300152
GMEB1 MS Standard C13 and N15-labeled recombinant protein (NP_077808)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200152]
Predicted MW 61.3 kDa
Protein Sequence
Protein Sequence
>RC200152 protein sequence
Red=Cloning site Green=Tags(s)

MANAEVSVPVGDVVVVPTEGNEGENPEDTKTQVILQLQPVQQGIYEAGSENNTAVVAVETHTIHKIEEGI
DTGTIEANEDMEIAYPITCGESKAILLWKKFVCPGINVKCVKFNDQLISPKHFVHLAGKSTLKDWKRAIR
LGGIMLRKMMDSGQIDFYQHDKVCSNTCRSTKFDLLISSARAPVPGQQTSVVQTPTSADGSITQIAISEE
SMEEAGLEWNSALTAAVTMATEEGVKKDSEEISEDTLMFWKGIADVGLMEEVVCNIQKEIEELLRGVQQR
LIQAPFQVTDAAVLNNVAHTFGLMDTVKKVLDNRRNQVEQGEEQFLYTLTDLERQLEEQKKQGQDHRLKS
QTVQNVVLMPVSTPKPPKRPRLQRPASTTVLSPSPPVQQPQFTVISPITITPVGQSFSMGNIPVATLSQG
SSPVTVHTLPSGPQLFRYATVVSSAKSSSPDTVTIHPSSSLALLSSTAMQDGSTLGNMTTMVSPVELVAM
ESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAVILETELRTEEKVVAEMEEHQHQVHNVEIVV
LED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077808
RefSeq Size 2661
RefSeq ORF 1689
Synonyms P96PIF; PIF96
Locus ID 10691
UniProt ID Q9Y692
Cytogenetics 1p35.3
Summary This gene encodes a member of KDWK gene family which associates with GMEB2 protein. The GMEB1-GMEB2 complex is essential for parvovirus DNA replication. Studies in rat for a similar gene suggest that this gene's role is to modulate the transactivation of the glucocorticoid receptor when it is bound to glucocorticoid response elements. Three alternative spliced transcript variants encoding different isoforms exist. [provided by RefSeq, Feb 2016]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:GMEB1 (NM_024482) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH317117 GMEB1 MS Standard C13 and N15-labeled recombinant protein (NP_006573) 10 ug
$3,255.00
LC411280 GMEB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411280 Transient overexpression lysate of glucocorticoid modulatory element binding protein 1 (GMEB1), transcript variant 2 100 ug
$436.00
TP300152 Recombinant protein of human glucocorticoid modulatory element binding protein 1 (GMEB1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP317117 Recombinant protein of human glucocorticoid modulatory element binding protein 1 (GMEB1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP710006 Recombinant protein of human glucocorticoid modulatory element binding protein 1 (GMEB1), full length, with C-terminal polyhistidine tag,expressed in sf9 cells 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.