HAO1 (NM_017545) Human Mass Spec Standard

CAT#: PH316834

HAO1 MS Standard C13 and N15-labeled recombinant protein (NP_060015)

Product Images

Coomassie blue staining of purified HAO1 protein (Cat# TP316834). The protein was produced from HEK293T cells transfected with HAO1 cDNA clone (Cat# RC216834) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216834
• Predicted MW: 40.9 kDa
• Protein Sequence:
  Sequence Link

  >RC216834 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLPRLICINDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQR
  VSMPICVGATAMQRMAHVDGELATVRACQSLGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVT
  KKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLPPQLRMKNFETSTLSFSPEENFGDDSGLAAYVA
  KAIDPSISWEDIKWLRRLTSLPIVAKGILRGDDAREAVKHGLNGILVSNHGARQLDGVPATIDVLPEIVE
  AVEGKVEVFLDGGVRKGTDVLKALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQ
  NVKVIDKTLVRKNPLAVSKI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060015
• RefSeq Size: 1746
• RefSeq ORF: 1110
• Synonyms: GOX; GOX1; HAOX1
• Locus ID: 54363
• UniProt ID: Q9UJM8, A8K058
• Cytogenetics: 20p12.3
• Summary: This gene is one of three related genes that have 2-hydroxyacid oxidase activity yet differ in encoded protein amino acid sequence, tissue expression and substrate preference. Subcellular location of the encoded protein is the peroxisome. Specifically, this gene is expressed primarily in liver and pancreas and the encoded protein is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids. The transcript detected at high levels in pancreas may represent an alternatively spliced form or the use of a multiple near-consensus upstream polyadenylation site. [provided by RefSeq, Jul 2008]
• Protein Pathways: Glyoxylate and dicarboxylate metabolism, Metabolic pathways