OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRCD (NM_001077620) Human Mass Spec Standard

Be the first to review this product
SKU
PH316764
PRCD MS Standard C13 and N15-labeled recombinant protein (NP_001071088)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY421463 Transient overexpression lysate of progressive rod-cone degeneration (PRCD) (as WB positive control) 100 ug
$436.00

Other products for "PRCD or NM_001077620"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216764
Predicted MW 5.8 kDa
Protein Sequence
Protein Sequence
>RC216764 representing NM_001077620
Red=Cloning site Green=Tags(s)

MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001071088
RefSeq Size 937
RefSeq ORF 162
Synonyms RP36
Locus ID 768206
UniProt ID Q00LT1
Cytogenetics 17q25.1
Summary This gene is predominantly expressed in the retina, and mutations in this gene are the cause of autosomal recessive retinal degeneration in both humans and dogs. Alternatively spliced transcript variants have been found for this gene. provided by RefSeq, Mar 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PRCD" proteins (3)
SKU Description Size Price
LC421463 Lyophilized PRCD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421463 Transient overexpression lysate of progressive rod-cone degeneration (PRCD) (as WB positive control) 100 ug
$436.00
TP316764 Recombinant protein of human progressive rod-cone degeneration (PRCD), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products