OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SCRN3 (NM_024583) Human Mass Spec Standard

Be the first to review this product
SKU
PH316491
SCRN3 MS Standard C13 and N15-labeled recombinant protein (NP_078859)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA320014 Rabbit Polyclonal SCRN3 Antibody
100 ug
$640.00
LY434219 Transient overexpression lysate of secernin 3 (SCRN3), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "SCRN3 or NM_024583"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216491
Predicted MW 48.5 kDa
Protein Sequence
Protein Sequence
>RC216491 protein sequence
Red=Cloning site Green=Tags(s)

MEPFSCDTFVALPPATVDNRIIFGKNSDRLYDEVQEVVYFPAVVHDNLGERLKCTYIEIDQVPETYAVVL
SRPAWLWGAEMGANEHGVCIGNEAVWGREEVCDEEALLGMDLVRLGLERADTAEKALNVIVDLLEKYGQG
GNCTEGRMVFSYHNSFLIADRNEAWILETAGKYWAAEKVQEGVRNISNQLSITTKIAREHPDMRNYAKRK
GWWDGKKEFDFAAAYSYLDTAKMMTSSGRYCEGYKLLNKHKGNITFETMMEILRDKPSGINMEGEFLTTA
SMVSILPQDSSLPCIHFFTGTPDPERSVFKPFIFVPHISQLLDTSSPTFELEDLVKKKSHFKPDRRHPLY
QKHQQALEVVNNNEEKAKIMLDNMRKLEKELFREMESILQNKHLDVEKIVNLFPQCTKDEIQIYQSNLSV
KVSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_078859
RefSeq Size 3071
RefSeq ORF 1272
Synonyms SES3
Locus ID 79634
UniProt ID Q0VDG4
Cytogenetics 2q31.1
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SCRN3" proteins (5)
SKU Description Size Price
LC411218 Lyophilized SCRN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434219 Lyophilized SCRN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411218 Transient overexpression lysate of secernin 3 (SCRN3) (as WB positive control) 100 ug
$665.00
LY434219 Transient overexpression lysate of secernin 3 (SCRN3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP316491 Recombinant protein of human secernin 3 (SCRN3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products