RAD1 (NM_002853) Human Mass Spec Standard

CAT#: PH316420

RAD1 MS Standard C13 and N15-labeled recombinant protein (NP_002844)

Product Images

Coomassie blue staining of purified RAD1 protein (Cat# TP316420). The protein was produced from HEK293T cells transfected with RAD1 cDNA clone (Cat# RC216420) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216420
• Predicted MW: 31.8 kDa
• Protein Sequence:
  Sequence Link

  >RC216420 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIF
  QEFKVQEESVTFRINLTVLLDCLSIFGSSPMPGTLTALRMCYQGYGYPLMLFLEEGGVVTVCKINTQEPE
  ETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLM
  EAFHCNQTQVNRYKISLLKPSTKALVLSCKVSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPES
  ES
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002844
• RefSeq Size: 4683
• RefSeq ORF: 846
• Synonyms: HRAD1; REC1
• Locus ID: 5810
• UniProt ID: O60671, A0A024R045
• Cytogenetics: 5p13.2
• Summary: This gene encodes a component of a heterotrimeric cell cycle checkpoint complex, known as the 9-1-1 complex, that is activated to stop cell cycle progression in response to DNA damage or incomplete DNA replication. The 9-1-1 complex is recruited by RAD17 to affected sites where it may attract specialized DNA polymerases and other DNA repair effectors. Alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Jan 2009]
• Protein Families: Druggable Genome