OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COMMD6 (NM_203495) Human Mass Spec Standard

Be the first to review this product
SKU
PH316105
COMMD6 MS Standard C13 and N15-labeled recombinant protein (NP_987091)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365261 COMMD6 rabbit polyclonal antibody
100 ul
$310.00
LY404247 Transient overexpression lysate of COMM domain containing 6 (COMMD6), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "COMMD6 or NM_203495"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216105
Predicted MW 9.6 kDa
Protein Sequence
Protein Sequence
>RC216105 protein sequence
Red=Cloning site Green=Tags(s)

MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQN
FYRQFKEIAAVIETV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_987091
RefSeq Size 1695
RefSeq ORF 255
Synonyms Acrg
Locus ID 170622
UniProt ID Q7Z4G1
Cytogenetics 13q22.2
Summary COMMD6 belongs to a family of NF-kappa-B (see RELA; MIM 164014)-inhibiting proteins characterized by the presence of a COMM domain (see COMMD1; MIM 607238) (de Bie et al., 2006 PubMed 16573520).supplied by OMIM, Mar 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COMMD6" proteins (3)
SKU Description Size Price
LC404247 Lyophilized COMMD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404247 Transient overexpression lysate of COMM domain containing 6 (COMMD6), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP316105 Recombinant protein of human COMM domain containing 6 (COMMD6), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products