OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NRBP2 (NM_178564) Human Mass Spec Standard

Be the first to review this product
SKU
PH315861
NRBP2 MS Standard C13 and N15-labeled recombinant protein (NP_848659)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344187 Rabbit Polyclonal Anti-NRBP2 Antibody - middle region
100 ul
$585.00
LY405879 Transient overexpression lysate of nuclear receptor binding protein 2 (NRBP2) (as WB positive control) 100 ug
$436.00

Other products for "NRBP2 or NM_178564"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215861
Predicted MW 29.9 kDa
Protein Sequence
Protein Sequence
>RC215861 protein sequence
Red=Cloning site Green=Tags(s)

MCALEMAVLEIQTNGDTRVTEEAIARARHSLSDPNMREFILCCLARDPARRPSAHSLLFHRVLFEVHSLK
LLAAHCFIQHQYLMPENVVEEKTKAMDLHAVLAELPRPRRPPLQWRYSEVSFMELDKFLEDVRNGIYPLM
NFAATRPLGLPRVLAPPPEEVQKAKTPTPEPFDSETRKVIQMQCNLERSEDKARWHLTLLLVLEDRLHRQ
LTYDLLPTDSAQDLASELVHYGFLHEDDRMKLAAFLESTFLKYRGTQA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_848659
RefSeq Size 3723
RefSeq ORF 774
Synonyms pp9320; TRG16
Locus ID 340371
UniProt ID Q9NSY0
Cytogenetics 8q24.3
Summary May regulate apoptosis of neural progenitor cells during their differentiation.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Protein Kinase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NRBP2" proteins (3)
SKU Description Size Price
LC405879 Lyophilized NRBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405879 Transient overexpression lysate of nuclear receptor binding protein 2 (NRBP2) (as WB positive control) 100 ug
$436.00
TP315861 Recombinant protein of human nuclear receptor binding protein 2 (NRBP2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products