OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TIGD6 (NM_030953) Human Mass Spec Standard

Be the first to review this product
SKU
PH315809
TIGD6 MS Standard C13 and N15-labeled recombinant protein (NP_112215)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY410617 Transient overexpression lysate of tigger transposable element derived 6 (TIGD6) (as WB positive control) 100 ug
$665.00

Other products for "TIGD6 or NM_030953"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215809
Predicted MW 58.7 kDa
Protein Sequence
Protein Sequence
>RC215809 protein sequence
Red=Cloning site Green=Tags(s)

MANKGNKKRRQFSLEEKMKVVGAVDSGKRKGDVAKEFGITPSTLSTFLKDRTKFEEKVREASVGPQRKRM
RSALYDDIDKAVFAWFQEIHAKNILVTGSVIRKKALNLANMLGYDNFQASVGWLNRFRDRHGIALKAVCR
EDSDRLMNGLGIDKINEWHAGEIIKLIADYSPDDIFNADETGVFFQLLPQHTLAAKGDHCRGGKKAKQRL
TALFCCNASGTEKMRPLIVGRSASPHCLKNIHSLPCDYRANQWAWMTRDLFNEWLMQVDARMKRAERRIL
LLIDNCSAHNMLPHLERIQVGYLPSNCTAVLQPLNLGIIHTMKVLYRSHLLKQILLKLNSSEDQEEVDIK
QAIDMIAAAWWSVKPSTVVKCWQKAGIVPMEFAECDTESAASEPDIAIEKLWHTVAIATCVPNEVNFQDF
VTADDDLIISQDTDIIQDMVAGENTSEAGSEDEGEVSLPEQPKVTITEAISSVQKLRQFLSTCVDIPDAI
FGQLNGIDEYLMKRVTQTLIDSKITDFLQTK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112215
RefSeq Size 4001
RefSeq ORF 1563
Locus ID 81789
UniProt ID Q17RP2
Cytogenetics 5q32
Summary The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. provided by RefSeq, Oct 2009
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TIGD6" proteins (3)
SKU Description Size Price
LC410617 Lyophilized TIGD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410617 Transient overexpression lysate of tigger transposable element derived 6 (TIGD6) (as WB positive control) 100 ug
$665.00
TP315809 Recombinant protein of human tigger transposable element derived 6 (TIGD6), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products