OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Septin 3 (SEPT3) (NM_019106) Human Mass Spec Standard

Be the first to review this product
SKU
PH315714
SEPT3 MS Standard C13 and N15-labeled recombinant protein (NP_061979)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811196 SEPT3 mouse monoclonal antibody,clone OTI3H6 100 ul
$447.00
LY403438 Transient overexpression lysate of septin 3 (SEPT3), transcript variant A (as WB positive control) 100 ug
$436.00

Other products for "Septin 3 or NM_019106"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215714
Predicted MW 39.9 kDa
Protein Sequence
Protein Sequence
>RC215714 representing NM_019106
Red=Cloning site Green=Tags(s)

MSKGLPETRTDAAMSELVPEPRPKPAVPMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQS
GLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWE
PIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKAD
TMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGR
KTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPVSVDTEESHDSNP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061979
RefSeq Size 4656
RefSeq ORF 1050
Synonyms bK250D10.3; SEP3; SEPT3
Locus ID 55964
UniProt ID Q9UH03
Cytogenetics 22q13.2
Summary This gene belongs to the septin family of GTPases. Members of this family are required for cytokinesis. Expression is upregulated by retinoic acid in a human teratocarcinoma cell line. The specific function of this gene has not been determined. Alternative splicing of this gene results in several transcript variants encoding different isoforms. provided by RefSeq, May 2018
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Septin 3" proteins (7)
SKU Description Size Price
PH315771 SEPT3 MS Standard C13 and N15-labeled recombinant protein (NP_663786) 10 ug
$3,360.00
LC403438 Lyophilized 42250 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC412748 Lyophilized 42250 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403438 Transient overexpression lysate of septin 3 (SEPT3), transcript variant A (as WB positive control) 100 ug
$436.00
LY412748 Transient overexpression lysate of septin 3 (SEPT3), transcript variant B (as WB positive control) 100 ug
$436.00
TP315714 Recombinant protein of human septin 3 (SEPT3), transcript variant B, 20 µg 20 ug
$867.00
TP315771 Recombinant protein of human septin 3 (SEPT3), transcript variant A, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products