Septin 3 (SEPT3) (NM_145733) Human Mass Spec Standard

SKU
PH315771
SEPT3 MS Standard C13 and N15-labeled recombinant protein (NP_663786)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215771]
Predicted MW 40.5 kDa
Protein Sequence
Protein Sequence
>RC215771 representing NM_145733
Red=Cloning site Green=Tags(s)

MSKGLPETRTDAAMSELVPEPRPKPAVPMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQS
GLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWE
PIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKAD
TMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGR
KTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVP
ATPCPTAE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_663786
RefSeq Size 2469
RefSeq ORF 1074
Synonyms bK250D10.3; SEP3; SEPT3
Locus ID 55964
UniProt ID Q9UH03
Cytogenetics 22q13.2
Summary This gene belongs to the septin family of GTPases. Members of this family are required for cytokinesis. Expression is upregulated by retinoic acid in a human teratocarcinoma cell line. The specific function of this gene has not been determined. Alternative splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq, May 2018]
Write Your Own Review
You're reviewing:Septin 3 (SEPT3) (NM_145733) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH315714 SEPT3 MS Standard C13 and N15-labeled recombinant protein (NP_061979) 10 ug
$3,255.00
LC403438 42250 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC412748 42250 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403438 Transient overexpression lysate of septin 3 (SEPT3), transcript variant A 100 ug
$436.00
LY412748 Transient overexpression lysate of septin 3 (SEPT3), transcript variant B 100 ug
$436.00
TP315714 Recombinant protein of human septin 3 (SEPT3), transcript variant B, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315771 Recombinant protein of human septin 3 (SEPT3), transcript variant A, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.