Glutaredoxin 2 (GLRX2) (NM_016066) Human Mass Spec Standard

CAT#: PH315566

GLRX2 MS Standard C13 and N15-labeled recombinant protein (NP_057150)

Product Images

Coomassie blue staining of purified GLRX2 protein (Cat# TP315566). The protein was produced from HEK293T cells transfected with GLRX2 cDNA clone (Cat# RC215566) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215566
• Predicted MW: 18.5 kDa
• Protein Sequence:
  Sequence Link

  >RC215566 representing NM_016066
  Red=Cloning site Green=Tags(s)
  
  MNPRDKQVSRFSPLKDVYTWVALAGIQRSGSPGRTRSAARRMESNTSSSLENLATAPVNQIQETISDNCV
  VIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHR
  LHKEGKLLPLVHQCYLKKSKRKEFQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057150
• RefSeq Size: 1170
• RefSeq ORF: 495
• Synonyms: CGI-133; GRX2
• Locus ID: 51022
• UniProt ID: Q9NS18
• Cytogenetics: 1q31.2
• Summary: The protein encoded by this gene is a member of the glutaredoxin family of proteins, which maintain cellular thiol homeostasis. These proteins are thiol-disulfide oxidoreductases that use a glutathione-binding site and one or two active cysteines in their active site. This gene undergoes alternative splicing to produce multiple isoforms, one of which is ubiquitously expressed and localizes to mitochondria, where it functions in mitochondrial redox homeostasis and is important for the protection against and recovery from oxidative stress. Other isoforms, which have more restrictive expression patterns, show cytosolic and nuclear localization, and are thought to function in cellular differentiation and transformation, possibly with a role in tumor progression. [provided by RefSeq, Aug 2011]
• Protein Families: Transcription Factors