OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Glutaredoxin 2 (GLRX2) (NM_016066) Human Mass Spec Standard

Be the first to review this product
SKU
PH315566
GLRX2 MS Standard C13 and N15-labeled recombinant protein (NP_057150)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY414214 Transient overexpression lysate of glutaredoxin 2 (GLRX2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "Glutaredoxin 2 or NM_016066"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215566
Predicted MW 18.5 kDa
Protein Sequence
Protein Sequence
>RC215566 representing NM_016066
Red=Cloning site Green=Tags(s)

MNPRDKQVSRFSPLKDVYTWVALAGIQRSGSPGRTRSAARRMESNTSSSLENLATAPVNQIQETISDNCV
VIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHR
LHKEGKLLPLVHQCYLKKSKRKEFQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057150
RefSeq Size 1170
RefSeq ORF 495
Synonyms CGI-133; GRX2
Locus ID 51022
UniProt ID Q9NS18
Cytogenetics 1q31.2
Summary The protein encoded by this gene is a member of the glutaredoxin family of proteins, which maintain cellular thiol homeostasis. These proteins are thiol-disulfide oxidoreductases that use a glutathione-binding site and one or two active cysteines in their active site. This gene undergoes alternative splicing to produce multiple isoforms, one of which is ubiquitously expressed and localizes to mitochondria, where it functions in mitochondrial redox homeostasis and is important for the protection against and recovery from oxidative stress. Other isoforms, which have more restrictive expression patterns, show cytosolic and nuclear localization, and are thought to function in cellular differentiation and transformation, possibly with a role in tumor progression. provided by RefSeq, Aug 2011
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Glutaredoxin 2" proteins (3)
SKU Description Size Price
LC414214 Lyophilized GLRX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414214 Transient overexpression lysate of glutaredoxin 2 (GLRX2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP315566 Recombinant protein of human glutaredoxin 2 (GLRX2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products