Glutaredoxin 2 (GLRX2) (NM_016066) Human Tagged ORF Clone

SKU
RC215566
GLRX2 (Myc-DDK-tagged)-Human glutaredoxin 2 (GLRX2), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Glutaredoxin 2
Synonyms CGI-133; GRX2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC215566 representing NM_016066
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCCTCGAGATAAGCAAGTGAGCCGCTTCTCCCCTCTAAAGGATGTTTACACGTGGGTGGCACTCG
CTGGAATCCAGCGCTCGGGCAGCCCTGGGAGGACGCGCTCAGCTGCGAGGAGGATGGAGAGCAATACATC
ATCATCTTTGGAGAATTTAGCGACGGCGCCTGTGAACCAGATCCAAGAAACAATTTCTGATAATTGTGTG
GTGATTTTCTCAAAAACATCCTGTTCTTACTGTACAATGGCAAAAAAGCTTTTCCATGACATGAATGTTA
ACTATAAAGTGGTGGAACTGGACCTGCTTGAATATGGAAACCAGTTCCAAGATGCTCTTTACAAAATGAC
TGGTGAAAGAACTGTTCCAAGAATATTTGTCAATGGTACTTTTATTGGAGGTGCAACTGACACTCATAGG
CTTCACAAAGAAGGAAAATTGCTCCCACTAGTTCATCAGTGTTATTTAAAAAAAAGTAAGAGGAAAGAAT
TTCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215566 representing NM_016066
Red=Cloning site Green=Tags(s)

MNPRDKQVSRFSPLKDVYTWVALAGIQRSGSPGRTRSAARRMESNTSSSLENLATAPVNQIQETISDNCV
VIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHR
LHKEGKLLPLVHQCYLKKSKRKEFQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016066
ORF Size 495 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016066.4, NP_057150.2
RefSeq Size 1170 bp
RefSeq ORF 498 bp
Locus ID 51022
UniProt ID Q9NS18
Cytogenetics 1q31.2
Protein Families Transcription Factors
MW 18.5 kDa
Summary The protein encoded by this gene is a member of the glutaredoxin family of proteins, which maintain cellular thiol homeostasis. These proteins are thiol-disulfide oxidoreductases that use a glutathione-binding site and one or two active cysteines in their active site. This gene undergoes alternative splicing to produce multiple isoforms, one of which is ubiquitously expressed and localizes to mitochondria, where it functions in mitochondrial redox homeostasis and is important for the protection against and recovery from oxidative stress. Other isoforms, which have more restrictive expression patterns, show cytosolic and nuclear localization, and are thought to function in cellular differentiation and transformation, possibly with a role in tumor progression. [provided by RefSeq, Aug 2011]
Write Your Own Review
You're reviewing:Glutaredoxin 2 (GLRX2) (NM_016066) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC215566L1 Lenti ORF clone of Human glutaredoxin 2 (GLRX2), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC215566L2 Lenti ORF clone of Human glutaredoxin 2 (GLRX2), transcript variant 1, mGFP tagged 10 ug
$450.00
RC215566L3 Lenti ORF clone of Human glutaredoxin 2 (GLRX2), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC215566L4 Lenti ORF clone of Human glutaredoxin 2 (GLRX2), transcript variant 1, mGFP tagged 10 ug
$450.00
RG215566 GLRX2 (tGFP-tagged) - Human glutaredoxin 2 (GLRX2), transcript variant 1 10 ug
$350.00
SC304378 GLRX2 (untagged)-Human glutaredoxin 2 (GLRX2), transcript variant 1 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.