OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMPPE (NM_001039770) Human Mass Spec Standard

Be the first to review this product
SKU
PH315414
TMPPE MS Standard C13 and N15-labeled recombinant protein (NP_001034859)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA335897 Rabbit Polyclonal Anti-TMPPE Antibody
100 ul
$585.00
LY421823 Transient overexpression lysate of transmembrane protein with metallophosphoesterase domain (TMPPE), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "TMPPE or NM_001039770"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215414
Predicted MW 49.3 kDa
Protein Sequence
Protein Sequence
>RC215414 representing NM_001039770
Red=Cloning site Green=Tags(s)

MAIFRQLSLGAKATLAAVTVFVSMIASRSYLAESLELRAWRWLLRLQLALFVNSLLLIGSLYIWRSTVSN
LCHSPAAESTCFQLWKVVVLAFLALAHSSFFTMFFLVAEEPYLFSLAAYSCLGAYIIMLFFLFILSGMEQ
AYQLLAWRSGRVVGSLEKTRKLVLRPALAVGVTAVLSVAGILNAAQPPAVKTVEVPIHQLPASMNNLKIV
LLSDIHLGPTVGRTKMEMFVRMVNVLEPDITVIVGDLSDSEASVLRTAVAPLGQLHSHLGAYFVTGNHEY
YTSDVSNWFALLESLHVQPLHNENVKISATRAQRGGGGSGSGSEDEDWICLAGVDDIEADILHYSGHGMD
LDKALEGCSPDHTIILLAHQPLAAKRALQARPDINLILSGHTHAGQIFPLNVAAYLLNPFFAGLYQVAQA
TFVYVSPGTAYYGIPMRLGSRAEITELILQRSP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001034859
RefSeq Size 3962
RefSeq ORF 1359
Locus ID 643853
UniProt ID Q6ZT21
Cytogenetics 3p22.3
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMPPE" proteins (3)
SKU Description Size Price
LC421823 Lyophilized TMPPE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421823 Transient overexpression lysate of transmembrane protein with metallophosphoesterase domain (TMPPE), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP315414 Recombinant protein of human transmembrane protein with metallophosphoesterase domain (TMPPE), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products