OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPIN3 (NM_001010862) Human Mass Spec Standard

Be the first to review this product
SKU
PH315063
SPIN3 MS Standard C13 and N15-labeled recombinant protein (NP_001010862)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY423191 Transient overexpression lysate of spindlin family, member 3 (SPIN3), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SPIN3 or NM_001010862"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215063
Predicted MW 29 kDa
Protein Sequence
Protein Sequence
>RC215063 representing NM_001010862
Red=Cloning site Green=Tags(s)

MKTPFGKAAAGQRSRTGAGHGSVSVTMIKRKAAHKKHRSRPTSQPRGNIVGCRIQHGWKDGDEPLTQWKG
TVLDQVPVNPSLYLIKYDGFDCVYGLELHRDERVSSLEVLPNRVASSRISDTHLAEIMVGKAVEHIFETE
EGSKNEWRGMVLAQAPVMNTWFYITYEKDPVLYMYQLLDDYKDGDLRILQDSNDSPLAEREPGEVIDSLV
GKQVEYAKDDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001010862
RefSeq Size 4479
RefSeq ORF 774
Synonyms bA445O16.1; SPIN-3; TDRD27
Locus ID 169981
UniProt ID Q5JUX0
Cytogenetics Xp11.21
Summary Exhibits H3K4me3-binding activity.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPIN3" proteins (3)
SKU Description Size Price
LC423191 Lyophilized SPIN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423191 Transient overexpression lysate of spindlin family, member 3 (SPIN3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP315063 Recombinant protein of human spindlin family, member 3 (SPIN3), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products