OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPAG16 (NM_001025436) Human Mass Spec Standard

Be the first to review this product
SKU
PH315059
SPAG16 MS Standard C13 and N15-labeled recombinant protein (NP_001020607)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331229 Rabbit Polyclonal Anti-SPAG16 Antibody
100 ul
$585.00
LY411248 Transient overexpression lysate of sperm associated antigen 16 (SPAG16), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "SPAG16 or NM_001025436"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215059
Predicted MW 20.4 kDa
Protein Sequence
Protein Sequence
>RC215059 representing NM_001025436
Red=Cloning site Green=Tags(s)

MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIP
EGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKG
VTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001020607
RefSeq Size 1296
RefSeq ORF 549
Synonyms PF20; WDR29
Locus ID 79582
UniProt ID Q8N0X2
Cytogenetics 2q34
Summary Cilia and flagella are comprised of a microtubular backbone, the axoneme, which is organized by the basal body and surrounded by plasma membrane. SPAG16 encodes 2 major proteins that associate with the axoneme of sperm tail and the nucleus of postmeiotic germ cells, respectively (Zhang et al., 2007 PubMed 17699735).supplied by OMIM, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPAG16" proteins (7)
SKU Description Size Price
PH324705 SPAG16 MS Standard C13 and N15-labeled recombinant protein (NP_078808) 10 ug
$3,360.00
LC411248 Lyophilized SPAG16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422444 Lyophilized SPAG16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411248 Transient overexpression lysate of sperm associated antigen 16 (SPAG16), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY422444 Transient overexpression lysate of sperm associated antigen 16 (SPAG16), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP315059 Recombinant protein of human sperm associated antigen 16 (SPAG16), transcript variant 2, 20 µg 20 ug
$737.00
TP324705 Recombinant protein of human sperm associated antigen 16 (SPAG16), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products