GOSR1 (NM_001007024) Human Mass Spec Standard

CAT#: PH314955

GOSR1 MS Standard C13 and N15-labeled recombinant protein (NP_001007025)

Product Images

Coomassie blue staining of purified GOSR1 protein (Cat# TP314955). The protein was produced from HEK293T cells transfected with GOSR1 cDNA clone (Cat# RC214955) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214955
• Predicted MW: 28.61 kDa
• Protein Sequence:
  Sequence Link

  >RC214955 representing NM_001007024
  Red=Cloning site Green=Tags(s)
  
  MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETM
  AIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANFMAIRERENLMG
  SVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKSIHSKMNTLAN
  RFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001007025
• RefSeq Size: 5246
• RefSeq ORF: 750
• Synonyms: GOLIM2; GOS-28; GOS28; GOS28/P28; GS28; P28
• Locus ID: 9527
• UniProt ID: O95249
• Cytogenetics: 17q11.2
• Summary: This gene encodes a trafficking membrane protein which transports proteins among the endoplasmic reticulum and the Golgi and between Golgi compartments. This protein is considered an essential component of the Golgi SNAP receptor (SNARE) complex. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport