GOSR1 (NM_001007024) Human Recombinant Protein

SKU
TP314955
Recombinant protein of human golgi SNAP receptor complex member 1 (GOSR1), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214955 representing NM_001007024
Red=Cloning site Green=Tags(s)

MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETM
AIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANFMAIRERENLMG
SVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKSIHSKMNTLAN
RFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001007025
Locus ID 9527
UniProt ID O95249
Cytogenetics 17q11.2
RefSeq Size 5246
RefSeq ORF 750
Synonyms GOLIM2; GOS-28; GOS28; GOS28/P28; GS28; P28
Summary This gene encodes a trafficking membrane protein which transports proteins among the endoplasmic reticulum and the Golgi and between Golgi compartments. This protein is considered an essential component of the Golgi SNAP receptor (SNARE) complex. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Protein Pathways SNARE interactions in vesicular transport
Write Your Own Review
You're reviewing:GOSR1 (NM_001007024) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH314955 GOSR1 MS Standard C13 and N15-labeled recombinant protein (NP_001007025) 10 ug
$3,255.00
LC423566 GOSR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423567 GOSR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY423566 Transient overexpression lysate of golgi SNAP receptor complex member 1 (GOSR1), transcript variant 3 100 ug
$436.00
LY423567 Transient overexpression lysate of golgi SNAP receptor complex member 1 (GOSR1), transcript variant 2 100 ug
$436.00
TP760954 Purified recombinant protein of Human golgi SNAP receptor complex member 1 (GOSR1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.