GOSR1 (NM_001007024) Human Mass Spec Standard

SKU
PH314955
GOSR1 MS Standard C13 and N15-labeled recombinant protein (NP_001007025)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214955]
Predicted MW 28.61 kDa
Protein Sequence
Protein Sequence
>RC214955 representing NM_001007024
Red=Cloning site Green=Tags(s)

MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETM
AIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANFMAIRERENLMG
SVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKSIHSKMNTLAN
RFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001007025
RefSeq Size 5246
RefSeq ORF 750
Synonyms GOLIM2; GOS-28; GOS28; GOS28/P28; GS28; P28
Locus ID 9527
UniProt ID O95249
Cytogenetics 17q11.2
Summary This gene encodes a trafficking membrane protein which transports proteins among the endoplasmic reticulum and the Golgi and between Golgi compartments. This protein is considered an essential component of the Golgi SNAP receptor (SNARE) complex. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Protein Pathways SNARE interactions in vesicular transport
Write Your Own Review
You're reviewing:GOSR1 (NM_001007024) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC423566 GOSR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423567 GOSR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY423566 Transient overexpression lysate of golgi SNAP receptor complex member 1 (GOSR1), transcript variant 3 100 ug
$436.00
LY423567 Transient overexpression lysate of golgi SNAP receptor complex member 1 (GOSR1), transcript variant 2 100 ug
$436.00
TP314955 Recombinant protein of human golgi SNAP receptor complex member 1 (GOSR1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP760954 Purified recombinant protein of Human golgi SNAP receptor complex member 1 (GOSR1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.