OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PYDC2 (NM_001083308) Human Mass Spec Standard

Be the first to review this product
SKU
PH314665
PYDC2 MS Standard C13 and N15-labeled recombinant protein (NP_001076777)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY421211 Transient overexpression lysate of pyrin domain containing 2 (PYDC2) (as WB positive control) 100 ug
$436.00

Other products for "PYDC2 or NM_001083308"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214665
Predicted MW 10.6 kDa
Protein Sequence
Protein Sequence
>RC214665 representing NM_001083308
Red=Cloning site Green=Tags(s)

MASSAELDFNLQALLEQLSQDELSKFKSLIRTISLGKELQTVPQTEVDKANGKQLVEIFTSHSCSYWAGM
AAIQVFEKMNQTHLSGRADEHCVMPPP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001076777
RefSeq Size 294
RefSeq ORF 291
Synonyms cPOP2; POP2
Locus ID 152138
UniProt ID Q56P42
Cytogenetics 3q28
Summary May play a role in innate immunity by disrupting the interaction between PYCARD and NLRP3, thereby regulating the NLRP3 inflammasome (PubMed:17339483, PubMed:17178784). May also inhibit NF-kappa-B signaling distally by affecting the nuclear accumulation of RELA (PubMed:17339483, PubMed:24871464).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PYDC2" proteins (3)
SKU Description Size Price
LC421211 Lyophilized PYDC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421211 Transient overexpression lysate of pyrin domain containing 2 (PYDC2) (as WB positive control) 100 ug
$436.00
TP314665 Recombinant protein of human pyrin domain containing 2 (PYDC2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products