OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RIC8 (RIC8B) (NM_018157) Human Mass Spec Standard

Be the first to review this product
SKU
PH314610
RIC8B MS Standard C13 and N15-labeled recombinant protein (NP_060627)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344920 Rabbit Polyclonal Anti-RIC8B Antibody - middle region
100 ul
$585.00
LY413256 Transient overexpression lysate of resistance to inhibitors of cholinesterase 8 homolog B (C. elegans) (RIC8B) (as WB positive control) 100 ug
$665.00

Other products for "RIC8 or NM_018157"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214610
Predicted MW 58.8 kDa
Protein Sequence
Protein Sequence
>RC214610 representing NM_018157
Red=Cloning site Green=Tags(s)

MDEERALYIVRAGEAGAIERVLRDYSDKHRATFKFESTDEDKRKKLCEGIFKVLIKDIPTTCQVSCLEVL
RILSRDKKVLVPVTTKENMQILLRLAKLNELDDSLEKVSEFPVIVESLKCLCNIVFNSQMAQQLSLELNL
AAKLCNLLRKCKDRKFINDIKCFDLRLLFLLSLLHTDIRSQLRYELQGLPLLTQILESAFSIKWTDEYES
AIDHNGPPLSPQETDCAIEALKALFNVTVDSWKVHKESDSHQFRVMAAVLRHCLLIVGPTEDKTEELHSN
AVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFME
KRIDKGSSYREGLTPVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGV
KQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARGLLAGGRGDNWYSEDEDTDTEEYKNAKPKEELLKP
MGLKPDGTITPLEEALNQYSVIEETSSDTD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060627
RefSeq Size 4989
RefSeq ORF 1560
Synonyms hSyn; RIC8
Locus ID 55188
UniProt ID Q9NVN3
Cytogenetics 12q23.3
Summary Guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP. Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RIC8" proteins (4)
SKU Description Size Price
LC413256 Lyophilized RIC8B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413256 Transient overexpression lysate of resistance to inhibitors of cholinesterase 8 homolog B (C. elegans) (RIC8B) (as WB positive control) 100 ug
$665.00
TP314610 Recombinant protein of human resistance to inhibitors of cholinesterase 8 homolog B (C. elegans) (RIC8B), 20 µg 20 ug
$867.00
TP762690 Purified recombinant protein of Human resistance to inhibitors of cholinesterase 8 homolog B (C. elegans) (RIC8B), full length, with N-GST and C-His tag, expressed in E.coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products