OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CABP2 (NM_016366) Human Mass Spec Standard

Be the first to review this product
SKU
PH314556
CABP2 MS Standard C13 and N15-labeled recombinant protein (NP_057450)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY413985 Transient overexpression lysate of calcium binding protein 2 (CABP2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CABP2 or NM_016366"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214556
Predicted MW 24.3 kDa
Protein Sequence
Protein Sequence
>RC214556 representing NM_016366
Red=Cloning site Green=Tags(s)

MGNCAKRPWRRGPKDPLQWLGSPPRGSCPSPSSSPKEQGDPAPGVQGYSVLNSLVGPACIFLRPSIAATQ
LDRELRPEEIEELQVAFQEFDRDRDGYIGCRELGACMRTLGYMPTEMELIEISQQISGGKVDFEDFVELM
GPKLLAETADMIGVRELRDAFREFDTNGDGRISVGELRAALKALLGERLSQREVDEILQDVDLNGDGLVD
FEEFVRMMSR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057450
RefSeq Size 986
RefSeq ORF 660
Synonyms DFNB93
Locus ID 51475
UniProt ID Q9NPB3
Cytogenetics 11q13.2
Summary This gene belongs to a subfamily of calcium binding proteins that share similarity to calmodulin. Like calmodulin, these family members can likely stimulate calmodulin-dependent kinase II and the protein phosphatase calcineurin. Calcium binding proteins are an important component of calcium mediated cellular signal transduction. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jan 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CABP2" proteins (3)
SKU Description Size Price
LC413985 Lyophilized CABP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413985 Transient overexpression lysate of calcium binding protein 2 (CABP2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP314556 Recombinant protein of human calcium binding protein 2 (CABP2), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products