OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RANBP3 (NM_007322) Human Mass Spec Standard

Be the first to review this product
SKU
PH314493
RANBP3 MS Standard C13 and N15-labeled recombinant protein (NP_015561)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344302 Rabbit Polyclonal Anti-RANBP3 Antibody - N-terminal region
100 ul
$585.00
LY418541 Transient overexpression lysate of RAN binding protein 3 (RANBP3), transcript variant RANBP3-a (as WB positive control) 100 ug
$665.00

Other products for "RANBP3 or NM_007322"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214493
Predicted MW 60 kDa
Protein Sequence
Protein Sequence
>RC214493 representing NM_007322
Red=Cloning site Green=Tags(s)

MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHHGTGHPESAGEHALEPPAPAG
ASASTPPPPAPEAQLPPFPRELAGRSAGGSSPEGGEDSDREDGNYCPPVKRERTSSLTQFPPSQSEERSS
GFRLKPPTLIHGQAPSAGLPSQKPKEQQRSVLRPAVLQAPQPKALSQTVPSSGTNGVSLPADCTGAVPAA
SPDTAAWRSPSEAADEVCALEEKEPQKNESSNASEEEACEKKDPATQQAFVFGQNLRDRVKLINESVDEA
DMENAGHPSADTPTATNYFLQYISSSLENSTNSADASSNKFVFGQNMSERVLSPPKLNEVSSDANRENAA
AESGSESSSQEATPEKESLAESAAAYTKATARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWVE
RGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIRITAMDTEDQGVKVFLI
SASSKDTGQLYAALHHRILALRSRVEQEQEAKMPAPEPGAAPSNEEDDSDDDDVLAPSGATAAGAGDEGD
GQTTGST

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_015561
RefSeq Size 2439
RefSeq ORF 1701
Locus ID 8498
UniProt ID Q9H6Z4
Cytogenetics 19p13.3
Summary This gene encodes a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RANBP3" proteins (9)
SKU Description Size Price
PH324944 RANBP3 MS Standard C13 and N15-labeled recombinant protein (NP_015559) 10 ug
$3,360.00
LC416048 Lyophilized RANBP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416049 Lyophilized RANBP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418541 Lyophilized RANBP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416048 Transient overexpression lysate of RAN binding protein 3 (RANBP3), transcript variant RANBP3-b (as WB positive control) 100 ug
$665.00
LY416049 Transient overexpression lysate of RAN binding protein 3 (RANBP3), transcript variant RANBP3-d (as WB positive control) 100 ug
$665.00
LY418541 Transient overexpression lysate of RAN binding protein 3 (RANBP3), transcript variant RANBP3-a (as WB positive control) 100 ug
$665.00
TP314493 Purified recombinant protein of Homo sapiens RAN binding protein 3 (RANBP3), transcript variant RANBP3-d, 20 µg 20 ug
$867.00
TP324944 Recombinant protein of human RAN binding protein 3 (RANBP3), transcript variant RANBP3-b, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products