OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPIN4 (NM_001012968) Human Mass Spec Standard

Be the first to review this product
SKU
PH314332
SPIN4 MS Standard C13 and N15-labeled recombinant protein (NP_001012986)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY422845 Transient overexpression lysate of spindlin family, member 4 (SPIN4) (as WB positive control) 100 ug
$436.00

Other products for "SPIN4 or NM_001012968"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214332
Predicted MW 28.7 kDa
Protein Sequence
Protein Sequence
>RC214332 protein sequence
Red=Cloning site Green=Tags(s)

MSPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVK
PTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGM
VLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSLVGKQVEHAKD
DGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001012986
RefSeq Size 4112
RefSeq ORF 747
Synonyms TDRD28
Locus ID 139886
UniProt ID Q56A73
Cytogenetics Xq11.1
Summary Exhibits H3K4me3-binding activity.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPIN4" proteins (3)
SKU Description Size Price
LC422845 Lyophilized SPIN4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422845 Transient overexpression lysate of spindlin family, member 4 (SPIN4) (as WB positive control) 100 ug
$436.00
TP314332 Recombinant protein of human spindlin family, member 4 (SPIN4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products