OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AARD (NM_001025357) Human Mass Spec Standard

Be the first to review this product
SKU
PH314088
C8orf85 MS Standard C13 and N15-labeled recombinant protein (NP_001020528)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY422434 Transient overexpression lysate of chromosome 8 open reading frame 85 (C8orf85) (as WB positive control) 100 ug
$436.00

Other products for "AARD or NM_001025357"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214088
Predicted MW 17.4 kDa
Protein Sequence
Protein Sequence
>RC214088 representing NM_001025357
Red=Cloning site Green=Tags(s)

MGPGDFRRCRERISQGLQGLPGRAELWFPPRPACDFFGDGRSTDIQEEALAASPLLEDLRRRLTRAFQWA
VQRAISRRVQEAAAAAAAREEQSWTGVEATLARLRAELVEMHFQNHQLARTLLDLNMKVQQLKKEYELEI
TSDSQSPKDDAANPE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001020528
RefSeq Size 751
RefSeq ORF 465
Synonyms C8orf85
Locus ID 441376
UniProt ID Q4LEZ3
Cytogenetics 8q24.11
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AARD" proteins (3)
SKU Description Size Price
LC422434 Lyophilized AARD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422434 Transient overexpression lysate of chromosome 8 open reading frame 85 (C8orf85) (as WB positive control) 100 ug
$436.00
TP314088 Recombinant protein of human chromosome 8 open reading frame 85 (C8orf85), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products