OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CDC42 (NM_001791) Human Mass Spec Standard

Be the first to review this product
SKU
PH314076
CDC42 MS Standard C13 and N15-labeled recombinant protein (NP_001782)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY421832 Transient overexpression lysate of cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "CDC42 or NM_001791"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214076
Predicted MW 21.1 kDa
Protein Sequence
Protein Sequence
>RC214076 representing NM_001791
Red=Cloning site Green=Tags(s)

MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPL
SYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPE
TAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001782
RefSeq Size 2183
RefSeq ORF 573
Synonyms CDC42Hs; G25K; TKS
Locus ID 998
UniProt ID P60953
Cytogenetics 1p36.12
Summary The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. Pseudogenes of this gene have been identified on chromosomes 3, 4, 5, 7, 8 and 20. provided by RefSeq, Apr 2013
Protein Families Druggable Genome
Protein Pathways Adherens junction, Axon guidance, Chemokine signaling pathway, Endocytosis, Epithelial cell signaling in Helicobacter pylori infection, Fc gamma R-mediated phagocytosis, Focal adhesion, GnRH signaling pathway, Leukocyte transendothelial migration, MAPK signaling pathway, Neurotrophin signaling pathway, Pancreatic cancer, Pathogenic Escherichia coli infection, Pathways in cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway, Tight junction, VEGF signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CDC42" proteins (11)
SKU Description Size Price
PH316559 CDC42 MS Standard C13 and N15-labeled recombinant protein (NP_426359) 10 ug
$3,360.00
PH319153 CDC42 MS Standard C13 and N15-labeled recombinant protein (NP_001034891) 10 ug
$3,360.00
LC400679 Lyophilized CDC42 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409470 Lyophilized CDC42 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421832 Lyophilized CDC42 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400679 Transient overexpression lysate of cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY409470 Transient overexpression lysate of cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY421832 Transient overexpression lysate of cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP314076 Recombinant protein of human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, 20 µg 20 ug
$867.00
TP316559 Recombinant protein of human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, 20 µg 20 ug
$867.00
TP319153 Recombinant protein of human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products