OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TBCE (NM_001079515) Human Mass Spec Standard

Be the first to review this product
SKU
PH314027
TBCE MS Standard C13 and N15-labeled recombinant protein (NP_001072983)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA357946 TBCE Antibody - C-terminal region
100 ul
$585.00
LY421507 Transient overexpression lysate of tubulin folding cofactor E (TBCE), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "TBCE or NM_001079515"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214027
Predicted MW 59.3 kDa
Protein Sequence
Protein Sequence
>RC214027 protein sequence
Red=Cloning site Green=Tags(s)

MSDTLTADVIGRRVEVNGEHATVRFAGVVPPVAGPWLGVEWDNPERGKHDGSHEGTVYFKCRHPTGGSFI
RPNKVNFGTDFLTAIKNRYVLEDGPEEDRKEQIVTIGNKPVETIGFDSIMKQQSQLSKLQEVSLRNCAVS
CAGEKGGVAEACPNIRKVDLSKNLLSSWDEVIHIADQLRHLEVLNVSENKLKFPSGSVLTGTLSVLKVLV
LNQTGITWAEVLRCVAGCPGLEELYLESNNIFISERPTDVLQTVKLLDLSSNQLIDENQLYLIAHLPRLE
QLILSDTGISSLHFPDAGIGCKTSMFPSLKYLVVNDNQISQWSFFNELEKLPSLRALSCLRNPLTKEDKE
AETARLLIIASIGQLKTLNKCEILPEERRRAELDYRKAFGNEWKQAGGHKDPEKNRLSEEFLTAHPRYQF
LCLKYGAPEDWELKTQQPLMLKNQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSRLLKVPVSDLL
LSYESPKKPGREIELENDLKSLQFYSVENGDCLLVRW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001072983
RefSeq Size 2025
RefSeq ORF 1581
Synonyms HRD; KCS; KCS1; pac2; PEAMO
Locus ID 6905
UniProt ID Q15813
Cytogenetics 1q42.3
Summary Cofactor E is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. Two transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TBCE" proteins (7)
SKU Description Size Price
PH301927 TBCE MS Standard C13 and N15-labeled recombinant protein (NP_003184) 10 ug
$3,360.00
LC418845 Lyophilized TBCE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421507 Lyophilized TBCE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418845 Transient overexpression lysate of tubulin folding cofactor E (TBCE), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY421507 Transient overexpression lysate of tubulin folding cofactor E (TBCE), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP301927 Recombinant protein of human tubulin folding cofactor E (TBCE), transcript variant 2, 20 µg 20 ug
$737.00
TP314027 Recombinant protein of human tubulin folding cofactor E (TBCE), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products