OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ADPRM (NM_020233) Human Mass Spec Standard

Be the first to review this product
SKU
PH313957
C17orf48 MS Standard C13 and N15-labeled recombinant protein (NP_064618)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344799 Rabbit Polyclonal Anti-C17orf48 Antibody - middle region
100 ul
$585.00
LY412569 Transient overexpression lysate of chromosome 17 open reading frame 48 (C17orf48) (as WB positive control) 100 ug
$436.00

Other products for "ADPRM or NM_020233"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213957
Predicted MW 39.3 kDa
Protein Sequence
Protein Sequence
>RC213957 representing NM_020233
Red=Cloning site Green=Tags(s)

MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLLHLQGAIEDWNNESSMPCCVL
QLGDIIDGYNAQYNASKKSLELVMDMFKRLKVPVHHTWGNHEFYNFSREYLTHSKLNTKFLEDQIVHHPE
TMPSEDYYAYHFVPFPKFRFILLDAYDLSVLGVDQSSPKYEQCMKILREHNPNTELNSPQGLSEPQFVQF
NGGFSQEQLNWLNEVLTFSDTNQEKVVIVSHLPIYPDASDNVCLAWNYRDALAVIWSHECVVCFFAGHTH
DGGYSEDPFGVYHVNLEGVIETAPDSQAFGTVHVYPDKMMLKGRGRVPDRIMNYKKERAFHC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_064618
RefSeq Size 1518
RefSeq ORF 1026
Synonyms C17orf48; MDS006; NBLA03831
Locus ID 56985
UniProt ID Q3LIE5
Cytogenetics 17p13.1
Summary Hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second-messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ADPRM" proteins (3)
SKU Description Size Price
LC412569 Lyophilized ADPRM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412569 Transient overexpression lysate of chromosome 17 open reading frame 48 (C17orf48) (as WB positive control) 100 ug
$436.00
TP313957 Recombinant protein of human chromosome 17 open reading frame 48 (C17orf48), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products